Lineage for d1ndga2 (1ndg A:108-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365795Domain d1ndga2: 1ndg A:108-214 [85577]
    Other proteins in same PDB: d1ndga1, d1ndgb1, d1ndgb2, d1ndgc_
    a part of Fab HYHEL-8
    complexed with acy; mutant

Details for d1ndga2

PDB Entry: 1ndg (more details), 1.9 Å

PDB Description: crystal structure of fab fragment of antibody hyhel-8 complexed with its antigen lysozyme

SCOP Domain Sequences for d1ndga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndga2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1ndga2:

Click to download the PDB-style file with coordinates for d1ndga2.
(The format of our PDB-style files is described here.)

Timeline for d1ndga2: