Lineage for d1nd0g2 (1nd0 G:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656342Domain d1nd0g2: 1nd0 G:108-214 [85572]
    Other proteins in same PDB: d1nd0a1, d1nd0b1, d1nd0b2, d1nd0c1, d1nd0d1, d1nd0d2, d1nd0e1, d1nd0f1, d1nd0f2, d1nd0g1, d1nd0h1, d1nd0h2
    part of cationic cyclization catalytic Fab 4C6
    complexed with dp4, so4

Details for d1nd0g2

PDB Entry: 1nd0 (more details), 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog
PDB Compounds: (G:) immunoglobulin igg2a

SCOP Domain Sequences for d1nd0g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd0g2 b.1.1.2 (G:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1nd0g2:

Click to download the PDB-style file with coordinates for d1nd0g2.
(The format of our PDB-style files is described here.)

Timeline for d1nd0g2: