Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
Domain d1nd0f2: 1nd0 F:114-231 [85570] Other proteins in same PDB: d1nd0a1, d1nd0a2, d1nd0b1, d1nd0c1, d1nd0c2, d1nd0d1, d1nd0e1, d1nd0e2, d1nd0f1, d1nd0g1, d1nd0g2, d1nd0h1 |
PDB Entry: 1nd0 (more details), 2.45 Å
SCOP Domain Sequences for d1nd0f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nd0f2 b.1.1.2 (F:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
Timeline for d1nd0f2: