Lineage for d1nd0e1 (1nd0 E:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451743Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 451856Domain d1nd0e1: 1nd0 E:1-107 [85567]
    Other proteins in same PDB: d1nd0a2, d1nd0b1, d1nd0b2, d1nd0c2, d1nd0d1, d1nd0d2, d1nd0e2, d1nd0f1, d1nd0f2, d1nd0g2, d1nd0h1, d1nd0h2

Details for d1nd0e1

PDB Entry: 1nd0 (more details), 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog

SCOP Domain Sequences for d1nd0e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd0e1 b.1.1.1 (E:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

SCOP Domain Coordinates for d1nd0e1:

Click to download the PDB-style file with coordinates for d1nd0e1.
(The format of our PDB-style files is described here.)

Timeline for d1nd0e1: