Lineage for d1nd0d2 (1nd0 D:114-231)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655590Domain d1nd0d2: 1nd0 D:114-231 [85566]
    Other proteins in same PDB: d1nd0a1, d1nd0a2, d1nd0b1, d1nd0c1, d1nd0c2, d1nd0d1, d1nd0e1, d1nd0e2, d1nd0f1, d1nd0g1, d1nd0g2, d1nd0h1

Details for d1nd0d2

PDB Entry: 1nd0 (more details), 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog
PDB Compounds: (D:) immunoglobulin igg2a

SCOP Domain Sequences for d1nd0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd0d2 b.1.1.2 (D:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

SCOP Domain Coordinates for d1nd0d2:

Click to download the PDB-style file with coordinates for d1nd0d2.
(The format of our PDB-style files is described here.)

Timeline for d1nd0d2: