Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein CD86 (b7-2), N-terminal domain [63635] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63636] (2 PDB entries) |
Domain d1ncnb_: 1ncn B: [85554] |
PDB Entry: 1ncn (more details), 2.7 Å
SCOP Domain Sequences for d1ncnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncnb_ b.1.1.1 (B:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens)} mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
Timeline for d1ncnb_: