Lineage for d1ncnb_ (1ncn B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362728Protein CD86 (b7-2), N-terminal domain [63635] (1 species)
  7. 362729Species Human (Homo sapiens) [TaxId:9606] [63636] (2 PDB entries)
  8. 362731Domain d1ncnb_: 1ncn B: [85554]

Details for d1ncnb_

PDB Entry: 1ncn (more details), 2.7 Å

PDB Description: the receptor-binding domain of human B7-2

SCOP Domain Sequences for d1ncnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncnb_ b.1.1.1 (B:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens)}
mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

SCOP Domain Coordinates for d1ncnb_:

Click to download the PDB-style file with coordinates for d1ncnb_.
(The format of our PDB-style files is described here.)

Timeline for d1ncnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ncna_