| Class b: All beta proteins [48724] (180 folds) |
| Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll |
Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families) ![]() |
| Family b.123.1.1: Hypothetical protein TM1070 [89233] (1 protein) automatically mapped to Pfam PF07100 |
| Protein Hypothetical protein TM1070 [89234] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [89235] (1 PDB entry) |
| Domain d1nc7c1: 1nc7 C:1-114 [85551] Other proteins in same PDB: d1nc7a2, d1nc7a3, d1nc7b2, d1nc7c2, d1nc7d2, d1nc7d3 structural genomics complexed with cl, edo, fmt, mg |
PDB Entry: 1nc7 (more details), 1.55 Å
SCOPe Domain Sequences for d1nc7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nc7c1 b.123.1.1 (C:1-114) Hypothetical protein TM1070 {Thermotoga maritima [TaxId: 2336]}
mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveisp
mkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigywee
Timeline for d1nc7c1: