SCOPe 2.04: Domain d1nc7b_: 1nc7 B:

Lineage for d1nc7b_ (1nc7 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families)

5. Family b.123.1.1: Hypothetical protein TM1070 [89233] (1 protein)
   automatically mapped to Pfam PF07100

6. Protein Hypothetical protein TM1070 [89234] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89235] (1 PDB entry)

8. Domain d1nc7b_: 1nc7 B: [85550]
   structural genomics
   complexed with cl, edo, fmt, mg

Details for d1nc7b_

PDB Entry: 1nc7, 1.55 Å

PDB Description: crystal structure of thermotoga maritima 1070

PDB Compounds: (B:) hypothetical protein TM1070

SCOPe Domain Sequences for d1nc7b_:

Sequence; same for both SEQRES and ATOM records:

>d1nc7b_ b.123.1.1 (B:) Hypothetical protein TM1070 {Thermotoga maritima [TaxId: 2336]}
mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveisp
mkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigyweegs

Timeline for d1nc7b_:

• d1nc7b_ first appeared in SCOP 1.65
  
• d1nc7b_ appears in SCOPe 2.03
  
• d1nc7b_ appears in SCOPe 2.05
  
• d1nc7b_ appears in the current release, SCOPe 2.08, called d1nc7b1