Lineage for d1nc7b1 (1nc7 B:1-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824318Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2824319Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families) (S)
  5. 2824320Family b.123.1.1: Hypothetical protein TM1070 [89233] (1 protein)
    automatically mapped to Pfam PF07100
  6. 2824321Protein Hypothetical protein TM1070 [89234] (1 species)
  7. 2824322Species Thermotoga maritima [TaxId:2336] [89235] (1 PDB entry)
  8. 2824324Domain d1nc7b1: 1nc7 B:1-114 [85550]
    Other proteins in same PDB: d1nc7a2, d1nc7a3, d1nc7b2, d1nc7c2, d1nc7d2, d1nc7d3
    structural genomics
    complexed with cl, edo, fmt, mg

Details for d1nc7b1

PDB Entry: 1nc7 (more details), 1.55 Å

PDB Description: crystal structure of thermotoga maritima 1070
PDB Compounds: (B:) hypothetical protein TM1070

SCOPe Domain Sequences for d1nc7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc7b1 b.123.1.1 (B:1-114) Hypothetical protein TM1070 {Thermotoga maritima [TaxId: 2336]}
mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveisp
mkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigywee

SCOPe Domain Coordinates for d1nc7b1:

Click to download the PDB-style file with coordinates for d1nc7b1.
(The format of our PDB-style files is described here.)

Timeline for d1nc7b1: