Lineage for d1nc7a_ (1nc7 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304969Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 304970Superfamily b.123.1: Hypothetical protein TM1070 [89232] (1 family) (S)
  5. 304971Family b.123.1.1: Hypothetical protein TM1070 [89233] (1 protein)
  6. 304972Protein Hypothetical protein TM1070 [89234] (1 species)
  7. 304973Species Thermotoga maritima [TaxId:243274] [89235] (1 PDB entry)
  8. 304974Domain d1nc7a_: 1nc7 A: [85549]

Details for d1nc7a_

PDB Entry: 1nc7 (more details), 1.55 Å

PDB Description: crystal structure of thermotoga maritima 1070

SCOP Domain Sequences for d1nc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc7a_ b.123.1.1 (A:) Hypothetical protein TM1070 {Thermotoga maritima}
hmngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveis
pmkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigyweeg

SCOP Domain Coordinates for d1nc7a_:

Click to download the PDB-style file with coordinates for d1nc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nc7a_: