Lineage for d1nc3a_ (1nc3 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) 
complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) 
Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species) 
Species Escherichia coli [TaxId:562] [82449] (8 PDB entries) 
Domain d1nc3a_: 1nc3 A: [85546]
complexed with fmc
Details for d1nc3a_
PDB Entry: 1nc3 (more details), 2.2 Å
PDB Description: Crystal structure of E. coli MTA/AdoHcy nucleosidase complexed with formycin A (FMA)
PDB Compounds: (A:) MTA/SAH nucleosidaseSCOPe Domain Sequences for d1nc3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nc3a_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
efsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaal
gatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpa
gfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeata
iahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
SCOPe Domain Coordinates for d1nc3a_:
Click to download the PDB-style file with coordinates for d1nc3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nc3a_:
- d1nc3a_ first appeared in SCOP 1.65
- d1nc3a_ appears in SCOPe 2.04
- d1nc3a_ is called d1nc3a1 in SCOPe 2.06
- d1nc3a_ appears in the current release, SCOPe 2.08, called d1nc3a1
View in 3D
