SCOP 1.65: Domain d1nbzb2: 1nbz B:414-510

Lineage for d1nbzb2 (1nbz B:414-510)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1nbzb2: 1nbz B:414-510 [85544]
   Other proteins in same PDB: d1nbza1, d1nbza2, d1nbzb1, d1nbzc_
   part of anti-lysozyme Fab HYHEL-63
   mutant

Details for d1nbzb2

PDB Entry: 1nbz, 1.85 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k97a

SCOP Domain Sequences for d1nbzb2:

Sequence; same for both SEQRES and ATOM records:

>d1nbzb2 b.1.1.2 (B:414-510) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

Timeline for d1nbzb2:

• d1nbzb2 is new in SCOP 1.65
  
• d1nbzb2 appears in SCOP 1.67
  
• d1nbzb2 appears in the current release, SCOPe 2.08