SCOP 1.65: Domain d1nbza1: 1nbz A:1-107

Lineage for d1nbza1 (1nbz A:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1nbza1: 1nbz A:1-107 [85541]
   Other proteins in same PDB: d1nbza2, d1nbzb1, d1nbzb2, d1nbzc_
   part of anti-lysozyme Fab HYHEL-63
   mutant

Details for d1nbza1

PDB Entry: 1nbz, 1.85 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k97a

SCOP Domain Sequences for d1nbza1:

Sequence; same for both SEQRES and ATOM records:

>d1nbza1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1nbza1:

• d1nbza1 is new in SCOP 1.65
  
• d1nbza1 appears in SCOP 1.67
  
• d1nbza1 appears in the current release, SCOPe 2.08