SCOPe 2.04: Domain d1nbyc_: 1nby C:

Lineage for d1nbyc_ (1nby C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Chicken (Gallus gallus) [TaxId:9031] [53962] (531 PDB entries)
   Uniprot P00698

8. Domain d1nbyc_: 1nby C: [85540]
   Other proteins in same PDB: d1nbya1, d1nbya2, d1nbyb1, d1nbyb2
   complexed with HYHEL-63
   mutant

Details for d1nbyc_

PDB Entry: 1nby, 1.8 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k96a

PDB Compounds: (C:) Lysozyme C

SCOPe Domain Sequences for d1nbyc_:

Sequence; same for both SEQRES and ATOM records:

>d1nbyc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncaakivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1nbyc_:

• d1nbyc_ first appeared in SCOP 1.65
  
• d1nbyc_ appears in SCOPe 2.03
  
• d1nbyc_ appears in SCOPe 2.05
  
• d1nbyc_ appears in the current release, SCOPe 2.08