Lineage for d1nbyc_ (1nby C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 596021Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 596029Species Chicken (Gallus gallus) [TaxId:9031] [53962] (190 PDB entries)
  8. 596137Domain d1nbyc_: 1nby C: [85540]
    Other proteins in same PDB: d1nbya1, d1nbya2, d1nbyb1, d1nbyb2
    complexed with HYHEL-63
    mutant

Details for d1nbyc_

PDB Entry: 1nby (more details), 1.8 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k96a

SCOP Domain Sequences for d1nbyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbyc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncaakivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1nbyc_:

Click to download the PDB-style file with coordinates for d1nbyc_.
(The format of our PDB-style files is described here.)

Timeline for d1nbyc_: