Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (190 PDB entries) |
Domain d1nbyc_: 1nby C: [85540] Other proteins in same PDB: d1nbya1, d1nbya2, d1nbyb1, d1nbyb2 complexed with HYHEL-63 mutant |
PDB Entry: 1nby (more details), 1.8 Å
SCOP Domain Sequences for d1nbyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbyc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncaakivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1nbyc_:
View in 3D Domains from other chains: (mouse over for more information) d1nbya1, d1nbya2, d1nbyb1, d1nbyb2 |