Lineage for d1nbyb2 (1nby B:414-510)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289202Domain d1nbyb2: 1nby B:414-510 [85539]
    Other proteins in same PDB: d1nbya1, d1nbya2, d1nbyb1, d1nbyc_
    part of anti-lysozyme Fab HYHEL-63
    mutant

Details for d1nbyb2

PDB Entry: 1nby (more details), 1.8 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k96a

SCOP Domain Sequences for d1nbyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbyb2 b.1.1.2 (B:414-510) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

SCOP Domain Coordinates for d1nbyb2:

Click to download the PDB-style file with coordinates for d1nbyb2.
(The format of our PDB-style files is described here.)

Timeline for d1nbyb2: