Lineage for d1nbya2 (1nby A:108-214)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454072Domain d1nbya2: 1nby A:108-214 [85537]
    Other proteins in same PDB: d1nbya1, d1nbyb1, d1nbyb2, d1nbyc_
    part of anti-lysozyme Fab HYHEL-63

Details for d1nbya2

PDB Entry: 1nby (more details), 1.8 Å

PDB Description: Crystal Structure of HyHEL-63 complexed with HEL mutant K96A

SCOP Domain Sequences for d1nbya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbya2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1nbya2:

Click to download the PDB-style file with coordinates for d1nbya2.
(The format of our PDB-style files is described here.)

Timeline for d1nbya2: