SCOP 1.65: Domain d1nboo2: 1nbo O:149-312

Lineage for d1nboo2 (1nbo O:149-312)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (3 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (2 PDB entries)

8. Domain d1nboo2: 1nbo O:149-312 [85531]
   Other proteins in same PDB: d1nboa1, d1nbob1, d1nboo1

Details for d1nboo2

PDB Entry: 1nbo, 2.6 Å

PDB Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD

SCOP Domain Sequences for d1nboo2:

Sequence; same for both SEQRES and ATOM records:

>d1nboo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

Timeline for d1nboo2:

• d1nboo2 is new in SCOP 1.65
  
• d1nboo2 appears in SCOP 1.67
  
• d1nboo2 appears in the current release, SCOPe 2.08