SCOP 1.65: Domain d1nboo1: 1nbo O:0-148,O:313-334

Lineage for d1nboo1 (1nbo O:0-148,O:313-334)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (2 PDB entries)

8. Domain d1nboo1: 1nbo O:0-148,O:313-334 [85530]
   Other proteins in same PDB: d1nboa2, d1nbob2, d1nboo2

Details for d1nboo1

PDB Entry: 1nbo, 2.6 Å

PDB Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD

SCOP Domain Sequences for d1nboo1:

Sequence; same for both SEQRES and ATOM records:

>d1nboo1 c.2.1.3 (O:0-148,O:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwqa

Timeline for d1nboo1:

• d1nboo1 is new in SCOP 1.65
  
• d1nboo1 appears in SCOP 1.67
  
• d1nboo1 appears in the current release, SCOPe 2.08