| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (2 PDB entries) |
| Domain d1nboa1: 1nbo A:0-148,A:313-334 [85526] Other proteins in same PDB: d1nboa2, d1nbob2, d1nboo2 |
PDB Entry: 1nbo (more details), 2.6 Å
SCOP Domain Sequences for d1nboa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nboa1 c.2.1.3 (A:0-148,A:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwqa
Timeline for d1nboa1:
View in 3DDomains from other chains: (mouse over for more information) d1nbob1, d1nbob2, d1nboo1, d1nboo2 |