Lineage for d1nbib_ (1nbi B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318334Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 318335Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families) (S)
  5. 318357Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 318358Protein Glycine N-methyltransferase [53349] (1 species)
  7. 318359Species Rat (Rattus norvegicus) [TaxId:10116] [53350] (8 PDB entries)
  8. 318373Domain d1nbib_: 1nbi B: [85521]

Details for d1nbib_

PDB Entry: 1nbi (more details), 3 Å

PDB Description: structure of r175k mutated glycine n-methyltransferase complexed with s-adenosylmethionine, r175k:sam.

SCOP Domain Sequences for d1nbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbib_ c.66.1.5 (B:) Glycine N-methyltransferase {Rat (Rattus norvegicus)}
pdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrvldvacgtgvdsimlvee
gfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltldkdvpagdgfdaviclg
nsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyilstgcappgkniyyksd
ltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrlsyyphclasftelvqea
fggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

SCOP Domain Coordinates for d1nbib_:

Click to download the PDB-style file with coordinates for d1nbib_.
(The format of our PDB-style files is described here.)

Timeline for d1nbib_: