Class b: All beta proteins [48724] (149 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) |
Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins) |
Protein Riboflavin kinase [82116] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89338] (4 PDB entries) encoded by FLJ11149 |
Domain d1nb9a_: 1nb9 A: [85515] complexed with adp, mg, rbf |
PDB Entry: 1nb9 (more details), 1.7 Å
SCOP Domain Sequences for d1nb9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nb9a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens)} rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg dieeakkrlelpeylkikednffqvsk
Timeline for d1nb9a_: