![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) ![]() |
![]() | Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins) |
![]() | Protein Riboflavin kinase [82116] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89338] (4 PDB entries) encoded by FLJ11149 |
![]() | Domain d1nb0a_: 1nb0 A: [85506] complexed with adp, mg |
PDB Entry: 1nb0 (more details), 1.7 Å
SCOP Domain Sequences for d1nb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nb0a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens)} rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg dieeakkrlelpeylkikednffqvsk
Timeline for d1nb0a_: