SCOP 1.67: Domain d1nayb_: 1nay B:

Lineage for d1nayb_ (1nay B:)

1. Root: SCOP 1.67

2. Class k: Designed proteins [58788] (41 folds)

3. Fold k.3: Collagen-like peptides [58805] (1 superfamily)

4. Superfamily k.3.1: Collagen-like peptides [58806] (1 family)

5. Family k.3.1.1: Collagen-like peptides [58807] (1 protein)

6. Protein Collagen-like peptides [58808] (7 species)

7. Species Synthetic, [(pro-pro-gly)10]3 triple helix model [70052] (2 PDB entries)

8. Domain d1nayb_: 1nay B: [85503]

Details for d1nayb_

PDB Entry: 1nay, 2.6 Å

PDB Description: gpp-foldon:x-ray structure

SCOP Domain Sequences for d1nayb_:

Sequence; same for both SEQRES and ATOM records:

>d1nayb_ k.3.1.1 (B:) Collagen-like peptides {Synthetic, [(pro-pro-gly)10]3 triple helix model}
ppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

Timeline for d1nayb_:

• d1nayb_ first appeared in SCOP 1.65
  
• d1nayb_ appears in SCOP 1.69
  
• d1nayb_ appears in the current release, SCOPe 2.08, called d1nayb1