Lineage for d1nava1 (1nav A:148-408)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009318Protein Thyroid hormone receptor alpha1 (TR-alpha1) [48532] (1 species)
  7. 2009319Species Human (Homo sapiens) [TaxId:9606] [88962] (5 PDB entries)
  8. 2009324Domain d1nava1: 1nav A:148-408 [85500]
    Other proteins in same PDB: d1nava2
    complexed with ih5, so4

Details for d1nava1

PDB Entry: 1nav (more details), 2.5 Å

PDB Description: Thyroid Receptor Alpha in complex with an agonist selective for Thyroid Receptor Beta1
PDB Compounds: (A:) hormone receptor alpha 1, THRA1

SCOPe Domain Sequences for d1nava1:

Sequence, based on SEQRES records: (download)

>d1nava1 a.123.1.1 (A:148-408) Thyroid hormone receptor alpha1 (TR-alpha1) {Human (Homo sapiens) [TaxId: 9606]}
eemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsmpdg
dkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavry
dpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavllmst
drsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasrflh
mkvecptelfpplflevfedq

Sequence, based on observed residues (ATOM records): (download)

>d1nava1 a.123.1.1 (A:148-408) Thyroid hormone receptor alpha1 (TR-alpha1) {Human (Homo sapiens) [TaxId: 9606]}
eemirslqqrpeptpeewdlihiateahrstnakqrrkflpddigqspdgdkvdleafse
ftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavrydpesdtltls
gemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavllmstdrsgllcvdk
ieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasrflhmkvecptelf
pplflevfedq

SCOPe Domain Coordinates for d1nava1:

Click to download the PDB-style file with coordinates for d1nava1.
(The format of our PDB-style files is described here.)

Timeline for d1nava1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nava2