Lineage for d1nanl1 (1nan L:182-278)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291448Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1291720Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
    Uniprot P01901 22-299
  8. 1291810Domain d1nanl1: 1nan L:182-278 [85496]
    Other proteins in same PDB: d1nanh2, d1nani_, d1nanl2, d1nanp_

Details for d1nanl1

PDB Entry: 1nan (more details), 2.3 Å

PDB Description: mch class i h-2kb molecule complexed with pbm1 peptide
PDB Compounds: (L:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1nanl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nanl1 b.1.1.2 (L:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

SCOPe Domain Coordinates for d1nanl1:

Click to download the PDB-style file with coordinates for d1nanl1.
(The format of our PDB-style files is described here.)

Timeline for d1nanl1: