![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries) |
![]() | Domain d1nani_: 1nan I: [85495] Other proteins in same PDB: d1nanh1, d1nanh2, d1nanl1, d1nanl2 |
PDB Entry: 1nan (more details), 2.3 Å
SCOP Domain Sequences for d1nani_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nani_ b.1.1.2 (I:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1nani_: