Lineage for d1nanh2 (1nan H:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406441Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (41 PDB entries)
    Uniprot P01901 22-299
  8. 1406473Domain d1nanh2: 1nan H:1-181 [85494]
    Other proteins in same PDB: d1nanh1, d1nani_, d1nanl1, d1nanp_

Details for d1nanh2

PDB Entry: 1nan (more details), 2.3 Å

PDB Description: mch class i h-2kb molecule complexed with pbm1 peptide
PDB Compounds: (H:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1nanh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nanh2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1nanh2:

Click to download the PDB-style file with coordinates for d1nanh2.
(The format of our PDB-style files is described here.)

Timeline for d1nanh2: