SCOP 1.65: Domain d1nanh1: 1nan H:182-278

Lineage for d1nanh1 (1nan H:182-278)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (49 PDB entries)

8. Domain d1nanh1: 1nan H:182-278 [85493]
   Other proteins in same PDB: d1nanh2, d1nani_, d1nanl2, d1nanp_

Details for d1nanh1

PDB Entry: 1nan, 2.3 Å

PDB Description: mch class i h-2kb molecule complexed with pbm1 peptide

SCOP Domain Sequences for d1nanh1:

Sequence; same for both SEQRES and ATOM records:

>d1nanh1 b.1.1.2 (H:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1nanh1:

• d1nanh1 is new in SCOP 1.65
  
• d1nanh1 appears in SCOP 1.67
  
• d1nanh1 appears in the current release, SCOPe 2.08