SCOPe 2.07: Domain d1naml1: 1nam L:1-99

Lineage for d1naml1 (1nam L:1-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1naml1: 1nam L:1-99 [85492]
   Other proteins in same PDB: d1nama_, d1namb_, d1namh1, d1namh2, d1naml2

Details for d1naml1

PDB Entry: 1nam, 2.7 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (L:) Beta-2-microglobulin

SCOPe Domain Sequences for d1naml1:

Sequence; same for both SEQRES and ATOM records:

>d1naml1 b.1.1.2 (L:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1naml1:

• d1naml1 first appeared in SCOP 1.65, called d1naml_
  
• d1naml1 appears in SCOPe 2.06
  
• d1naml1 appears in the current release, SCOPe 2.08