Lineage for d1naml_ (1nam L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288544Protein beta2-microglobulin [88600] (4 species)
  7. 288646Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)
  8. 288714Domain d1naml_: 1nam L: [85492]
    Other proteins in same PDB: d1nama_, d1namb_, d1namh1, d1namh2
    complexed with nag

Details for d1naml_

PDB Entry: 1nam (more details), 2.7 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1naml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1naml_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus)}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1naml_:

Click to download the PDB-style file with coordinates for d1naml_.
(The format of our PDB-style files is described here.)

Timeline for d1naml_: