Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
Domain d1namb_: 1nam B: [85489] Other proteins in same PDB: d1namh1, d1namh2, d1naml1, d1naml2 |
PDB Entry: 1nam (more details), 2.7 Å
SCOPe Domain Sequences for d1namb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1namb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv
Timeline for d1namb_: