Lineage for d1nama_ (1nam A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105548Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 1105574Domain d1nama_: 1nam A: [85488]
    Other proteins in same PDB: d1namh1, d1namh2, d1naml_

Details for d1nama_

PDB Entry: 1nam (more details), 2.7 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
PDB Compounds: (A:) BM3.3 T Cell Receptor alpha-Chain

SCOPe Domain Sequences for d1nama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nama_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp

SCOPe Domain Coordinates for d1nama_:

Click to download the PDB-style file with coordinates for d1nama_.
(The format of our PDB-style files is described here.)

Timeline for d1nama_: