Lineage for d1nafa_ (1naf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696791Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 2696792Family a.7.8.1: GAT domain [89010] (4 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 2696793Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)
  7. 2696794Species Human (Homo sapiens) [TaxId:9606] [89012] (7 PDB entries)
    Uniprot Q9UJY5 211-299
  8. 2696801Domain d1nafa_: 1naf A: [85487]

Details for d1nafa_

PDB Entry: 1naf (more details), 2.8 Å

PDB Description: crystal structure of the human gga1 gat domain
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1nafa_:

Sequence, based on SEQRES records: (download)

>d1nafa_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
deekskmlarllksshpedlraanklikemvqedqkrmekiskrvnaieevnnnvkllte
mvmshsqggaaagssedlmkelyqrcermrptlfrlasdtedndealaeilqandnltqv
inlykqlvr

Sequence, based on observed residues (ATOM records): (download)

>d1nafa_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
deekskmlarllksshpedlraanklikemvqedqkrmekiskrvnaieevnnnvkllte
mvmshsqgssedlmkelyqrcermrptlfrlasdtedndealaeilqandnltqvinlyk
qlvr

SCOPe Domain Coordinates for d1nafa_:

Click to download the PDB-style file with coordinates for d1nafa_.
(The format of our PDB-style files is described here.)

Timeline for d1nafa_: