![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
![]() | Protein Putative xylanase [89239] (1 species) |
![]() | Species Clostridium stercorarium [TaxId:1510] [89240] (8 PDB entries) Uniprot P33558 243-374, 384-512 |
![]() | Domain d1naea_: 1nae A: [85486] third CBM6 module, CBM6-3, in complex with xylotriose complexed with ca |
PDB Entry: 1nae (more details), 2.05 Å
SCOPe Domain Sequences for d1naea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1naea_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium [TaxId: 1510]} ggtrsafsniqaedydssygpnlqifslpgggsaigyiengysttyknidfgdgatsvta rvatqnattiqvrlgspsgtllgtiyvgstgsfdtyrdvsatisntagvkdivlvfsgpv nvdwfvfsk
Timeline for d1naea_: