Lineage for d1na8a_ (1na8 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455905Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 455921Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
    consist of a single subdomain
  6. 455922Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)
  7. 455923Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)
  8. 455924Domain d1na8a_: 1na8 A: [85484]

Details for d1na8a_

PDB Entry: 1na8 (more details), 2.3 Å

PDB Description: crystal structure of adp-ribosylation factor binding protein gga1

SCOP Domain Sequences for d1na8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na8a_ b.1.10.2 (A:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens)}
hhhhmelslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsml
stapqpirnivfqsavpkvmkvklqppsgmelpafnpivhpsaitqvlllanpqkekvrl
rykltftmgdqtynemgdvdqfpppetwgsl

SCOP Domain Coordinates for d1na8a_:

Click to download the PDB-style file with coordinates for d1na8a_.
(The format of our PDB-style files is described here.)

Timeline for d1na8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1na8b_