Lineage for d1na8a1 (1na8 A:494-639)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764533Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 2764555Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. 2764556Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)
  7. 2764557Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)
  8. 2764560Domain d1na8a1: 1na8 A:494-639 [85484]
    Other proteins in same PDB: d1na8a2

Details for d1na8a1

PDB Entry: 1na8 (more details), 2.3 Å

PDB Description: crystal structure of adp-ribosylation factor binding protein gga1
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1na8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na8a1 b.1.10.2 (A:494-639) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
elslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapq
pirnivfqsavpkvmkvklqppsgmelpafnpivhpsaitqvlllanpqkekvrlryklt
ftmgdqtynemgdvdqfpppetwgsl

SCOPe Domain Coordinates for d1na8a1:

Click to download the PDB-style file with coordinates for d1na8a1.
(The format of our PDB-style files is described here.)

Timeline for d1na8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1na8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1na8b_