Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries) |
Domain d1na5a1: 1na5 A:130-319 [85483] Other proteins in same PDB: d1na5a2 |
PDB Entry: 1na5 (more details), 1.5 Å
SCOPe Domain Sequences for d1na5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1na5a1 c.62.1.1 (A:130-319) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} qedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkef qnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdp lgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiq nqlrekifai
Timeline for d1na5a1: