Lineage for d1na3b_ (1na3 B:)

  1. Root: SCOPe 2.07
  2. 2652352Class k: Designed proteins [58788] (44 folds)
  3. 2652890Fold k.38: TPR domain-based design [90307] (1 superfamily)
  4. 2652891Superfamily k.38.1: TPR domain-based design [90308] (1 family) (S)
  5. 2652892Family k.38.1.1: TPR domain-based design [90309] (3 proteins)
    alpha-helical arrays from an idealized TPR motif
  6. 2652897Protein Designed protein cTPR2 [90312] (1 species)
  7. 2652898Species Synthetic [90313] (1 PDB entry)
  8. 2652900Domain d1na3b_: 1na3 B: [85482]
    complexed with ipt, mg, trs

Details for d1na3b_

PDB Entry: 1na3 (more details), 1.55 Å

PDB Description: design of stable alpha-helical arrays from an idealized tpr motif
PDB Compounds: (B:) designed protein CTPR2

SCOPe Domain Sequences for d1na3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na3b_ k.38.1.1 (B:) Designed protein cTPR2 {Synthetic}
gnsaeawynlgnayykqgdydeaieyyqkaleldpnnaeawynlgnayykqgdydeaiey
yqkaleldpnnaeakqnlgnakqkqg

SCOPe Domain Coordinates for d1na3b_:

Click to download the PDB-style file with coordinates for d1na3b_.
(The format of our PDB-style files is described here.)

Timeline for d1na3b_: