Lineage for d1na3b_ (1na3 B:)

  1. Root: SCOP 1.65
  2. 348801Class k: Designed proteins [58788] (39 folds)
  3. 349240Fold k.38: TPR domain-based design [90307] (1 superfamily)
  4. 349241Superfamily k.38.1: TPR domain-based design [90308] (1 family) (S)
  5. 349242Family k.38.1.1: TPR domain-based design [90309] (2 proteins)
    alpha-helical arrays from an idealized TPR motif
  6. 349243Protein Designed protein cTPR2 [90312] (1 species)
  7. 349244Species Synthetic [90313] (1 PDB entry)
  8. 349246Domain d1na3b_: 1na3 B: [85482]

Details for d1na3b_

PDB Entry: 1na3 (more details), 1.55 Å

PDB Description: design of stable alpha-helical arrays from an idealized tpr motif

SCOP Domain Sequences for d1na3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na3b_ k.38.1.1 (B:) Designed protein cTPR2 {Synthetic}
gnsaeawynlgnayykqgdydeaieyyqkaleldpnnaeawynlgnayykqgdydeaiey
yqkaleldpnnaeakqdlgnakqkqg

SCOP Domain Coordinates for d1na3b_:

Click to download the PDB-style file with coordinates for d1na3b_.
(The format of our PDB-style files is described here.)

Timeline for d1na3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1na3a_