Lineage for d1na0b_ (1na0 B:)

  1. Root: SCOPe 2.05
  2. 1975766Class k: Designed proteins [58788] (44 folds)
  3. 1976301Fold k.38: TPR domain-based design [90307] (1 superfamily)
  4. 1976302Superfamily k.38.1: TPR domain-based design [90308] (1 family) (S)
  5. 1976303Family k.38.1.1: TPR domain-based design [90309] (3 proteins)
    alpha-helical arrays from an idealized TPR motif
  6. 1976312Protein Designed protein cTPR3 [90310] (1 species)
  7. 1976313Species Synthetic [90311] (1 PDB entry)
  8. 1976315Domain d1na0b_: 1na0 B: [85480]
    complexed with act, cl, ipt, mg, na, pb

Details for d1na0b_

PDB Entry: 1na0 (more details), 1.6 Å

PDB Description: design of stable alpha-helical arrays from an idealized tpr motif
PDB Compounds: (B:) designed protein CTPR3

SCOPe Domain Sequences for d1na0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na0b_ k.38.1.1 (B:) Designed protein cTPR3 {Synthetic}
nsaeawynlgnayykqgdydeaieyyqkaleldpnnaeawynlgnayykqgdydeaieyy
qkaleldpnnaeawynlgnayykqgdydeaieyyqkaleldpnnaeakqnlgnakqkqg

SCOPe Domain Coordinates for d1na0b_:

Click to download the PDB-style file with coordinates for d1na0b_.
(The format of our PDB-style files is described here.)

Timeline for d1na0b_: