SCOPe 2.05: Domain d1n9wa1: 1n9w A:1-93

Lineage for d1n9wa1 (1n9w A:1-93)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
   this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes

7. Species Thermus thermophilus, AspRS-2 [TaxId:274] [89323] (1 PDB entry)
   non-discriminating and archaeal-type enzyme

8. Domain d1n9wa1: 1n9w A:1-93 [85473]
   Other proteins in same PDB: d1n9wa2, d1n9wb2

Details for d1n9wa1

PDB Entry: 1n9w, 2.3 Å

PDB Description: Crystal structure of the non-discriminating and archaeal-type aspartyl-tRNA synthetase from Thermus thermophilus

PDB Compounds: (A:) aspartyl-tRNA synthetase 2

SCOPe Domain Sequences for d1n9wa1:

Sequence; same for both SEQRES and ATOM records:

>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]}
mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr
vrglvvenakapgglevqakevevlspaleptp

Timeline for d1n9wa1:

• d1n9wa1 first appeared in SCOP 1.65
  
• d1n9wa1 appears in SCOPe 2.04
  
• d1n9wa1 appears in SCOPe 2.06
  
• d1n9wa1 appears in the current release, SCOPe 2.08