Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
Species Thermus thermophilus, AspRS-2 [TaxId:274] [89323] (1 PDB entry) non-discriminating and archaeal-type enzyme |
Domain d1n9wa1: 1n9w A:1-93 [85473] Other proteins in same PDB: d1n9wa2, d1n9wb2 |
PDB Entry: 1n9w (more details), 2.3 Å
SCOPe Domain Sequences for d1n9wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr vrglvvenakapgglevqakevevlspaleptp
Timeline for d1n9wa1: