Lineage for d1n9wa1 (1n9w A:1-93)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799408Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 799409Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 799433Species Thermus thermophilus, AspRS-2 [TaxId:274] [89323] (1 PDB entry)
    non-discriminating and archaeal-type enzyme
  8. 799434Domain d1n9wa1: 1n9w A:1-93 [85473]
    Other proteins in same PDB: d1n9wa2, d1n9wb2

Details for d1n9wa1

PDB Entry: 1n9w (more details), 2.3 Å

PDB Description: Crystal structure of the non-discriminating and archaeal-type aspartyl-tRNA synthetase from Thermus thermophilus
PDB Compounds: (A:) aspartyl-tRNA synthetase 2

SCOP Domain Sequences for d1n9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]}
mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr
vrglvvenakapgglevqakevevlspaleptp

SCOP Domain Coordinates for d1n9wa1:

Click to download the PDB-style file with coordinates for d1n9wa1.
(The format of our PDB-style files is described here.)

Timeline for d1n9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n9wa2