SCOPe 2.01: Domain d1n9ba_: 1n9b A:

Lineage for d1n9ba_ (1n9b A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Klebsiella pneumoniae, SHV-2 [TaxId:573] [90082] (10 PDB entries)
   almost identical sequence to SHV-1

8. Domain d1n9ba_: 1n9b A: [85463]
   complexed with epe, ma4, mpd

Details for d1n9ba_

PDB Entry: 1n9b, 0.9 Å

PDB Description: ultrahigh resolution structure of a class a beta-lactamase: on the mechanism and specificity of the extended-spectrum shv-2 enzyme

PDB Compounds: (A:) beta-lactamase shv-2

SCOPe Domain Sequences for d1n9ba_:

Sequence; same for both SEQRES and ATOM records:

>d1n9ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgasergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d1n9ba_:

• d1n9ba_ first appeared in SCOP 1.65
  
• d1n9ba_ appears in SCOP 1.75
  
• d1n9ba_ appears in SCOPe 2.02
  
• d1n9ba_ appears in the current release, SCOPe 2.08