SCOP 1.69: Domain d1n9ba_: 1n9b A:

Lineage for d1n9ba_ (1n9b A:)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Klebsiella pneumoniae, SHV-2 [TaxId:573] [90082] (1 PDB entry)
   almost identical sequence to SHV-1

8. Domain d1n9ba_: 1n9b A: [85463]

Details for d1n9ba_

PDB Entry: 1n9b, 0.9 Å

PDB Description: ultrahigh resolution structure of a class a beta-lactamase: on the mechanism and specificity of the extended-spectrum shv-2 enzyme

SCOP Domain Sequences for d1n9ba_:

Sequence; same for both SEQRES and ATOM records:

>d1n9ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgasergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d1n9ba_:

• d1n9ba_ first appeared in SCOP 1.65
  
• d1n9ba_ appears in SCOP 1.67
  
• d1n9ba_ appears in SCOP 1.71
  
• d1n9ba_ appears in the current release, SCOPe 2.08