SCOP 1.73: Domain d1n99b2: 1n99 B:195-272

Lineage for d1n99b2 (1n99 B:195-272)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1n99b2: 1n99 B:195-272 [85462]
   tandem of two PDZ domains
   complexed with mse

Details for d1n99b2

PDB Entry: 1n99, 1.94 Å

PDB Description: crystal structure of the pdz tandem of human syntenin

PDB Compounds: (B:) Syntenin 1

SCOP Domain Sequences for d1n99b2:

Sequence; same for both SEQRES and ATOM records:

>d1n99b2 b.36.1.1 (B:195-272) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
fertitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqi
adilstsgtvvtitimpa

Timeline for d1n99b2:

• d1n99b2 first appeared in SCOP 1.65
  
• d1n99b2 appears in SCOP 1.71
  
• d1n99b2 appears in SCOP 1.75
  
• d1n99b2 appears in the current release, SCOPe 2.08