Lineage for d1n99b2 (1n99 B:195-272)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296371Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 296372Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 296373Family b.36.1.1: PDZ domain [50157] (13 proteins)
  6. 296428Protein Syntenin 1 [89311] (1 species)
  7. 296429Species Human (Homo sapiens) [TaxId:9606] [89312] (5 PDB entries)
  8. 296441Domain d1n99b2: 1n99 B:195-272 [85462]
    tandem of two PDZ domains
    complexed with mse

Details for d1n99b2

PDB Entry: 1n99 (more details), 1.94 Å

PDB Description: crystal structure of the pdz tandem of human syntenin

SCOP Domain Sequences for d1n99b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n99b2 b.36.1.1 (B:195-272) Syntenin 1 {Human (Homo sapiens)}
fertitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqi
adilstsgtvvtitimpa

SCOP Domain Coordinates for d1n99b2:

Click to download the PDB-style file with coordinates for d1n99b2.
(The format of our PDB-style files is described here.)

Timeline for d1n99b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n99b1