SCOP 1.69: Domain d1n99b1: 1n99 B:110-194

Lineage for d1n99b1 (1n99 B:110-194)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (29 proteins)
   Pfam 00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (6 PDB entries)

8. Domain d1n99b1: 1n99 B:110-194 [85461]

Details for d1n99b1

PDB Entry: 1n99, 1.94 Å

PDB Description: crystal structure of the pdz tandem of human syntenin

SCOP Domain Sequences for d1n99b1:

Sequence; same for both SEQRES and ATOM records:

>d1n99b1 b.36.1.1 (B:110-194) Syntenin 1 {Human (Homo sapiens)}
mdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagw
ssdkahkvlkqafgekitmtirdrp

Timeline for d1n99b1:

• d1n99b1 first appeared in SCOP 1.65
  
• d1n99b1 appears in SCOP 1.67
  
• d1n99b1 appears in SCOP 1.71
  
• d1n99b1 appears in the current release, SCOPe 2.08